> >>>Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
New Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. View larger

Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00083953-Q01

New product

FCAMR (Human) Recombinant Protein (Q01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name FCAMR
Gene Alias FCA/MR|FKSG87
Gene Description Fc receptor, IgA, IgM, high affinity
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq TLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRLSQLSPDDIGC
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 83953

More info

Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.