View larger
Mouse Igf2 (P09535, 25 a.a. - 91 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8189
New product
Igf2 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | Igf2 |
| Gene Alias | AL033362|Igf-2|Igf-II|M6pr|Mpr|Peg2 |
| Gene Description | insulin-like growth factor 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 mg/mL |
| Gene ID | 16002 |
More info
Mouse Igf2 (P09535, 25 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.