View larger
Human SARS-CoV-2 S partial ORF (YP_009724390.1, 438 a.a. - 479 a.a.) recombinant protein with GST tag at N-terminal.
AB-P6694
New product
SARS-CoV-2 S (438 - 479) (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTP |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 43740568 |
More info
Human SARS-CoV-2 S partial ORF (YP_009724390.1, 438 a.a. - 479 a.a.) recombinant protein with GST tag at N-terminal.