View larger
Human RKHD1 partial ORF ( NP_976049, 418 a.a. - 488 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00399664-Q01
New product
RKHD1 (Human) Recombinant Protein (Q01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | MEX3D |
| Gene Alias | KIAA2031|MEX-3D|MEX3|OK/SW-cl.4|RKHD1|RNF193|TINO |
| Gene Description | mex-3 homolog D (C. elegans) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | LARECVVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQAIRVETETPQPGGASALQRQY |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 399664 |
More info
Human RKHD1 partial ORF ( NP_976049, 418 a.a. - 488 a.a.) recombinant protein with GST-tag at N-terminal.