> >>>Human SLC6A19 partial ORF ( NP_001003841, 326 a.a. - 414 a.a.) recombinant protein with GST-tag at N-terminal.
New SLC6A19 (Human) Recombinant Protein (Q01) View larger

Human SLC6A19 partial ORF ( NP_001003841, 326 a.a. - 414 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00340024-Q01

New product

SLC6A19 (Human) Recombinant Protein (Q01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name SLC6A19
Gene Alias B0AT1|FLJ20680|FLJ34635|HND
Gene Description solute carrier family 6 (neutral amino acid transporter), member 19
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GFRATQRYDDCFSTNILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGTGLAFIVFTEAITKMPLSP
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 340024

More info

Human SLC6A19 partial ORF ( NP_001003841, 326 a.a. - 414 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human SLC6A19 partial ORF ( NP_001003841, 326 a.a. - 414 a.a.) recombinant protein with GST-tag at N-terminal.

Human SLC6A19 partial ORF ( NP_001003841, 326 a.a. - 414 a.a.) recombinant protein with GST-tag at N-terminal.