View larger
Human BBS12 full-length ORF ( NP_689831.2, 1 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00166379-P01
New product
BBS12 (Human) Recombinant Protein (P01)
Não há pontos de recompensa para este produto.
Data sheet
| Size | 10 ug |
| Gene Name | BBS12 |
| Gene Alias | C4orf24|FLJ35630|FLJ41559 |
| Gene Description | Bardet-Biedl syndrome 12 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MVMACRVVNKRRHMGLQQLSSFAETGRTFLGPLKSSKFIIDEECHESVLISSTVRLLESLDLTSAVGQLLNEAVQAQNNTYRTGISTLLFLVGAWSSAVEECLHLGVPISIIVSVMSEGLNFCSEEVVSLHVPVHNIFDCMDSTKTFSQLETFSVSLCPFLQVPSDTDLIEELHGLKDVASQTLTISNLSGRPLKSYELFKPQTKVEADNNTSRTLKNSLLADTCCRQSILIHSRHFNRTDNTEGVSKPDGFQEH |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 166379 |
More info
Human BBS12 full-length ORF ( NP_689831.2, 1 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.