View larger
Human DTX3L partial ORF ( NP_612144, 3 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00151636-Q01
New product
DTX3L (Human) Recombinant Protein (Q01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | DTX3L |
| Gene Alias | BBAP |
| Gene Description | deltex 3-like (Drosophila) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | SHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAE |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 151636 |
More info
Human DTX3L partial ORF ( NP_612144, 3 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.