New TAF1L (Human) Recombinant Protein (Q01) View larger

Human TAF1L partial ORF ( NP_722516, 1532 a.a. - 1641 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00138474-Q01

New product

TAF1L (Human) Recombinant Protein (Q01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name TAF1L
Gene Alias MGC134910|TAF2A2
Gene Description TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa-like
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq NIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 138474

More info

Human TAF1L partial ORF ( NP_722516, 1532 a.a. - 1641 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human TAF1L partial ORF ( NP_722516, 1532 a.a. - 1641 a.a.) recombinant protein with GST-tag at N-terminal.

Human TAF1L partial ORF ( NP_722516, 1532 a.a. - 1641 a.a.) recombinant protein with GST-tag at N-terminal.