> >>>Human KRTAP3-3 full-length ORF ( NP_149441.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
New KRTAP3-3 (Human) Recombinant Protein (P01) View larger

Human KRTAP3-3 full-length ORF ( NP_149441.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00085293-P01

New product

KRTAP3-3 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name KRTAP3-3
Gene Alias KAP3.3|KRTAP3.3|MGC95374
Gene Description keratin associated protein 3-3
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MDCCASRGCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPTCCDNCPPPCHIPQPCVPTCFLLNSCQPTPGLETLNLTTFTQPCCEPCLPRGC
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 85293

More info

Human KRTAP3-3 full-length ORF ( NP_149441.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human KRTAP3-3 full-length ORF ( NP_149441.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

Human KRTAP3-3 full-length ORF ( NP_149441.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.