> >>>Human C20orf35 full-length ORF ( NP_291020.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.
New C20orf35 (Human) Recombinant Protein (P01) View larger

Human C20orf35 full-length ORF ( NP_291020.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00055861-P01

New product

C20orf35 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name DBNDD2
Gene Alias C20orf35|CK1BP|HSMNP1
Gene Description dysbindin (dystrobrevin binding protein 1) domain containing 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 55861

More info

Human C20orf35 full-length ORF ( NP_291020.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human C20orf35 full-length ORF ( NP_291020.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.

Human C20orf35 full-length ORF ( NP_291020.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.