VNN3 (Human) Recombinant Protein (Q01) View larger

Human VNN3 partial ORF ( NP_060869.2, 175 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00055350-Q01

New product

VNN3 (Human) Recombinant Protein (Q01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name VNN3
Gene Alias HSA238982|MGC171203|PAGEL-beta|PAGEL-eta|PAGEL-zeta
Gene Description vanin 3
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 55350

More info

Human VNN3 partial ORF ( NP_060869.2, 175 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human VNN3 partial ORF ( NP_060869.2, 175 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.

Human VNN3 partial ORF ( NP_060869.2, 175 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.