> >>>Human PC-LKC partial ORF ( NP_060145, 210 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.
New PC-LKC (Human) Recombinant Protein (Q01) View larger

Human PC-LKC partial ORF ( NP_060145, 210 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00054825-Q01

New product

PC-LKC (Human) Recombinant Protein (Q01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name PCDH24
Gene Alias FLJ20124|FLJ20383|MGC163154|PC-LKC|PCLKC
Gene Description protocadherin 24
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 54825

More info

Human PC-LKC partial ORF ( NP_060145, 210 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human PC-LKC partial ORF ( NP_060145, 210 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.

Human PC-LKC partial ORF ( NP_060145, 210 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.