View larger
Human UGT1A9 partial ORF ( NP_066307, 27 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00054600-Q01
New product
UGT1A9 (Human) Recombinant Protein (Q01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | UGT1A9 |
| Gene Alias | HLUGP4|LUGP4|UDPGT|UGT1AI |
| Gene Description | UDP glucuronosyltransferase 1 family, polypeptide A9 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | KLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEY |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 54600 |
More info
Human UGT1A9 partial ORF ( NP_066307, 27 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.