AB-H00054539-P01
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 10 ug |
Gene Name | NDUFB11 |
Gene Alias | ESSS|FLJ20494|MGC111182|NP17.3|Np15|P17.3 |
Gene Description | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Immunogen Prot. Seq | MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE |
Antigen species Target species | Human |
Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID | 54539 |