LRP12 (Human) Recombinant Protein (P01) View larger

Human LRP12 full-length ORF (-, 1 a.a. - 129 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00029967-P01

New product

LRP12 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name LRP12
Gene Alias DKFZp781F1053|FLJ12929|ST7
Gene Description low density lipoprotein-related protein 12
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MKIFYYALNLELYKTCTKIVQDKFHLVMSFPNTGLRLHWTLGICTKIISRSQMSLVHKHYHFKYYYLLPQQLYISIAFGWGRGTFLLQLEIALLVSYLFVVFKKYIVVRVIFSIYFIPGGDHATLSKEN
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 29967

More info

Human LRP12 full-length ORF (-, 1 a.a. - 129 a.a.) recombinant protein with GST tag at N-terminal.

Enviar uma mensagem

Human LRP12 full-length ORF (-, 1 a.a. - 129 a.a.) recombinant protein with GST tag at N-terminal.

Human LRP12 full-length ORF (-, 1 a.a. - 129 a.a.) recombinant protein with GST tag at N-terminal.