TIPARP (Human) Recombinant Protein (P01) View larger

Human TIPARP full-length ORF (CAL38311.1 , 1 a.a. - 657 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00025976-P01

New product

TIPARP (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name TIPARP
Gene Alias DDF1|DKFZp434J214|DKFZp686N0351|DKFZp686P1838|FLJ40466|PARP-1|PARP-7|PARP7
Gene Description TCDD-inducible poly(ADP-ribose) polymerase
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQIPEAHPSTEAPERVVPIQDHSFPSETLSGTVADSTPAHFQTDLLHPVSSDVPTSPDCLDKVIDYVPGIFQENSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGIEICMDFLQGTCIYGR
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 25976

More info

Human TIPARP full-length ORF (CAL38311.1 , 1 a.a. - 657 a.a.) recombinant protein with GST tag at N-terminal.

Enviar uma mensagem

Human TIPARP full-length ORF (CAL38311.1 , 1 a.a. - 657 a.a.) recombinant protein with GST tag at N-terminal.

Human TIPARP full-length ORF (CAL38311.1 , 1 a.a. - 657 a.a.) recombinant protein with GST tag at N-terminal.