NEDD4L (Human) Recombinant Protein (P01) View larger

Human NEDD4L full-length ORF ( AAH32597, 1 a.a. - 911 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00023327-P01

New product

NEDD4L (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name NEDD4L
Gene Alias FLJ33870|KIAA0439|NEDD4-2|RSP5|hNedd4-2
Gene Description neural precursor cell expressed, developmentally down-regulated 4-like
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHI
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 23327

More info

Human NEDD4L full-length ORF ( AAH32597, 1 a.a. - 911 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human NEDD4L full-length ORF ( AAH32597, 1 a.a. - 911 a.a.) recombinant protein with GST-tag at N-terminal.

Human NEDD4L full-length ORF ( AAH32597, 1 a.a. - 911 a.a.) recombinant protein with GST-tag at N-terminal.