View larger
Human DDX39 full-length ORF ( NP_005795.2, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00010212-P01
New product
DDX39 (Human) Recombinant Protein (P01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | DDX39 |
| Gene Alias | BAT1|BAT1L|DDXL|MGC18203|MGC8417|URH49 |
| Gene Description | DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETK |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 10212 |
More info
Human DDX39 full-length ORF ( NP_005795.2, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.