MFN2 (Human) Recombinant Protein (P01) View larger

Human MFN2 full-length ORF (NP_055689.1, 1 a.a. - 757 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00009927-P01

New product

MFN2 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 2 ug
Gene Name MFN2
Gene Alias CMT2A|CMT2A2|CPRP1|HSG|KIAA0214|MARF
Gene Description mitofusin 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFI
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 9927

More info

Human MFN2 full-length ORF (NP_055689.1, 1 a.a. - 757 a.a.) recombinant protein with GST tag at N-terminal.

Enviar uma mensagem

Human MFN2 full-length ORF (NP_055689.1, 1 a.a. - 757 a.a.) recombinant protein with GST tag at N-terminal.

Human MFN2 full-length ORF (NP_055689.1, 1 a.a. - 757 a.a.) recombinant protein with GST tag at N-terminal.