RNPC2 (Human) Recombinant Protein (Q01) View larger

Human RNPC2 partial ORF ( NP_909122, 423 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00009584-Q01

New product

RNPC2 (Human) Recombinant Protein (Q01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name RBM39
Gene Alias CAPER|CAPERalpha|CC1.3|DKFZp781C0423|FLJ44170|HCC1|RNPC2|fSAP59
Gene Description RNA binding motif protein 39
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 9584

More info

Human RNPC2 partial ORF ( NP_909122, 423 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human RNPC2 partial ORF ( NP_909122, 423 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.

Human RNPC2 partial ORF ( NP_909122, 423 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.