PCAF (Human) Recombinant Protein (Q02) View larger

Human PCAF partial ORF ( NP_003875, 731 a.a. - 832 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00008850-Q02

New product

PCAF (Human) Recombinant Protein (Q02)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name KAT2B
Gene Alias CAF|P|P/CAF|PCAF
Gene Description K(lysine) acetyltransferase 2B
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq TLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 8850

More info

Human PCAF partial ORF ( NP_003875, 731 a.a. - 832 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human PCAF partial ORF ( NP_003875, 731 a.a. - 832 a.a.) recombinant protein with GST-tag at N-terminal.

Human PCAF partial ORF ( NP_003875, 731 a.a. - 832 a.a.) recombinant protein with GST-tag at N-terminal.