New NRP1 (Human) Recombinant Protein (Q01) View larger

Human NRP1 partial ORF (NP_003864.4, 22 a.a. - 131 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00008829-Q01

New product

NRP1 (Human) Recombinant Protein (Q01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name NRP1
Gene Alias BDCA4|CD304|DKFZp686A03134|DKFZp781F1414|NP1|NRP|VEGF165R
Gene Description neuropilin 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 8829

More info

Human NRP1 partial ORF (NP_003864.4, 22 a.a. - 131 a.a.) recombinant protein with GST tag at N-terminal.

Enviar uma mensagem

Human NRP1 partial ORF (NP_003864.4, 22 a.a. - 131 a.a.) recombinant protein with GST tag at N-terminal.

Human NRP1 partial ORF (NP_003864.4, 22 a.a. - 131 a.a.) recombinant protein with GST tag at N-terminal.