AB-H00008519-P02
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 10 ug |
Gene Name | IFITM1 |
Gene Alias | 9-27|CD225|IFI17|LEU13 |
Gene Description | interferon induced transmembrane protein 1 (9-27) |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Immunogen Prot. Seq | MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY |
Antigen species Target species | Human |
Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID | 8519 |