PSCA (Human) Recombinant Protein (Q01) View larger

Human PSCA partial ORF ( NP_005663, 23 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00008000-Q01

New product

PSCA (Human) Recombinant Protein (Q01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name PSCA
Gene Alias PRO232
Gene Description prostate stem cell antigen
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 8000

More info

Human PSCA partial ORF ( NP_005663, 23 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human PSCA partial ORF ( NP_005663, 23 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

Human PSCA partial ORF ( NP_005663, 23 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.