TLR5 (Human) Recombinant Protein (Q03) View larger

Human TLR5 partial ORF (NP_003259.2, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00007100-Q03

New product

TLR5 (Human) Recombinant Protein (Q03)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name TLR5
Gene Alias FLJ10052|MGC126430|MGC126431|SLEB1|TIL3
Gene Description toll-like receptor 5
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILYFLLRVPHL
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 7100

More info

Human TLR5 partial ORF (NP_003259.2, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human TLR5 partial ORF (NP_003259.2, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.

Human TLR5 partial ORF (NP_003259.2, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.