PCSK1 (Human) Recombinant Protein (P01) View larger

Human PCSK1 full-length ORF (NP_000430.3, 1 a.a. - 753 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00005122-P01

New product

PCSK1 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name PCSK1
Gene Alias BMIQ12|NEC1|PC1|PC3|SPC3
Gene Description proprotein convertase subtilisin/kexin type 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MERRAWSLQCTAFVLFCAWCALNSAKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQIGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDGIVTDAIEASSIG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 5122

More info

Human PCSK1 full-length ORF (NP_000430.3, 1 a.a. - 753 a.a.) recombinant protein with GST tag at N-terminal.

Enviar uma mensagem

Human PCSK1 full-length ORF (NP_000430.3, 1 a.a. - 753 a.a.) recombinant protein with GST tag at N-terminal.

Human PCSK1 full-length ORF (NP_000430.3, 1 a.a. - 753 a.a.) recombinant protein with GST tag at N-terminal.