View larger
Human NHP2L1 full-length ORF ( NP_001003796.1, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00004809-P01
New product
NHP2L1 (Human) Recombinant Protein (P01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | NHP2L1 |
| Gene Alias | 15.5K|FA-1|FA1|NHPX|OTK27|SNRNP15-5|SNU13|SPAG12|SSFA1 |
| Gene Description | NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 4809 |
More info
Human NHP2L1 full-length ORF ( NP_001003796.1, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.