View larger
Human NUBP1 full-length ORF ( NP_002475.2, 1 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00004682-P01
New product
NUBP1 (Human) Recombinant Protein (P01)
Não há pontos de recompensa para este produto.
Data sheet
| Size | 10 ug |
| Gene Name | NUBP1 |
| Gene Alias | MGC117406|MGC130052|MGC130053|NBP|NBP1 |
| Gene Description | nucleotide binding protein 1 (MinD homolog, E. coli) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELM |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 4682 |
More info
Human NUBP1 full-length ORF ( NP_002475.2, 1 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.