ALDH6A1 (Human) Recombinant Protein (P01) View larger

Human ALDH6A1 full-length ORF ( AAH32371, 10 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00004329-P01

New product

ALDH6A1 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name ALDH6A1
Gene Alias MGC40271|MMSADHA|MMSDH
Gene Description aldehyde dehydrogenase 6 family, member A1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq VRARILQVSSKVKSSPTWYSASSFSSSVPTVKLFIGGKFVESKSDKWIDIHNPATNEVIGRVPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 4329

More info

Human ALDH6A1 full-length ORF ( AAH32371, 10 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human ALDH6A1 full-length ORF ( AAH32371, 10 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.

Human ALDH6A1 full-length ORF ( AAH32371, 10 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.