View larger
Human KCNN3 full-length ORF ( NP_740752.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00003782-P02
New product
KCNN3 (Human) Recombinant Protein (P02)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | KCNN3 |
| Gene Alias | KCa2.3|SK3|SKCA3|hSK3 |
| Gene Description | potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MERPIKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMM |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 3782 |
More info
Human KCNN3 full-length ORF ( NP_740752.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal.