IL11RA (Human) Recombinant Protein (P01) View larger

Human IL11RA full-length ORF ( AAH03110, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00003590-P01

New product

IL11RA (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name IL11RA
Gene Alias MGC2146
Gene Description interleukin 11 receptor, alpha
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3590

More info

Human IL11RA full-length ORF ( AAH03110, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human IL11RA full-length ORF ( AAH03110, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.

Human IL11RA full-length ORF ( AAH03110, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.