> >>>Human HPRT1 full-length ORF ( AAH00578, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
New HPRT1 (Human) Recombinant Protein (P01) View larger

Human HPRT1 full-length ORF ( AAH00578, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00003251-P01

New product

HPRT1 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name HPRT1
Gene Alias HGPRT|HPRT
Gene Description hypoxanthine phosphoribosyltransferase 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3251

More info

Human HPRT1 full-length ORF ( AAH00578, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human HPRT1 full-length ORF ( AAH00578, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

Human HPRT1 full-length ORF ( AAH00578, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.