> >>>Human HLA-DQB2 full-length ORF ( AAH31995, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.
New HLA-DQB2 (Human) Recombinant Protein (P01) View larger

Human HLA-DQB2 full-length ORF ( AAH31995, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00003120-P01

New product

HLA-DQB2 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name HLA-DQB2
Gene Alias HLA-DQB1|HLA-DXB
Gene Description major histocompatibility complex, class II, DQ beta 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3120

More info

Human HLA-DQB2 full-length ORF ( AAH31995, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human HLA-DQB2 full-length ORF ( AAH31995, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.

Human HLA-DQB2 full-length ORF ( AAH31995, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.