View larger
Human GBA partial ORF ( NP_000148.2, 431 a.a. - 536 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00002629-Q02
New product
GBA (Human) Recombinant Protein (Q02)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | GBA |
| Gene Alias | GBA1|GCB|GLUC |
| Gene Description | glucosidase, beta |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | NWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 2629 |
More info
Human GBA partial ORF ( NP_000148.2, 431 a.a. - 536 a.a.) recombinant protein with GST-tag at N-terminal.