> >>>Human CYP27B1 partial ORF ( NP_000776, 409 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal.
New CYP27B1 (Human) Recombinant Protein (Q01) View larger

Human CYP27B1 partial ORF ( NP_000776, 409 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00001594-Q01

New product

CYP27B1 (Human) Recombinant Protein (Q01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name CYP27B1
Gene Alias CP2B|CYP1|CYP1alpha|CYP27B|P450c1|PDDR|VDD1|VDDR|VDDRI|VDR
Gene Description cytochrome P450, family 27, subfamily B, polypeptide 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq TLCHYATSRDPAQFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1594

More info

Human CYP27B1 partial ORF ( NP_000776, 409 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human CYP27B1 partial ORF ( NP_000776, 409 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal.

Human CYP27B1 partial ORF ( NP_000776, 409 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal.