> >>>Human AREG full-length ORF ( NP_001648.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.
New AREG (Human) Recombinant Protein (P01) View larger

Human AREG full-length ORF ( NP_001648.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00000374-P01

New product

AREG (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name AREG
Gene Alias AR|CRDGF|MGC13647|SDGF
Gene Description amphiregulin
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 374

More info

Human AREG full-length ORF ( NP_001648.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human AREG full-length ORF ( NP_001648.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.

Human AREG full-length ORF ( NP_001648.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.