> >>>Human ADSS full-length ORF ( NP_001117.2, 1 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal.
ADSS (Human) Recombinant Protein (P02) View larger

Human ADSS full-length ORF ( NP_001117.2, 1 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00000159-P02

New product

ADSS (Human) Recombinant Protein (P02)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name ADSS
Gene Alias ADEH|MGC20404
Gene Description adenylosuccinate synthase
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGAN
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 159

More info

Human ADSS full-length ORF ( NP_001117.2, 1 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human ADSS full-length ORF ( NP_001117.2, 1 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal.

Human ADSS full-length ORF ( NP_001117.2, 1 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal.