View larger
Human FCRL5 (AAK93971, 16 a.a. - 851 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
AB-P9707
New product
FCRL5 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | FCRL5 |
| Gene Alias | BXMAS1|CD307|DKFZp667E2019|DKFZp667F216|FCRH5|FLJ00333|FLJ00397|IRTA2|MGC119590|MGC119592|MGC119593|PRO820 |
| Gene Description | Fc receptor-like 5 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | QFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFTRPVLRASSFQPISGNPVTLTCETQLSLERSDVPLRFRFFRDDQTLGLGWSLSPNFQITAMWSKDSGFYWCKAATMPYSVI |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SEC-HPLC and Tris-Bis PAGE |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 83416 |
More info
Human FCRL5 (AAK93971, 16 a.a. - 851 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.