View larger
Human CLEC4C (Q8WTT0-1, 46 a.a. - 213 a.a.) partial recombinant protein with His tag at N-terminus expressed in HEK293 cells.
AB-P9705
New product
CLEC4C (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | CLEC4C |
| Gene Alias | BDCA2|CD303|CLECSF11|CLECSF7|DLEC|HECL|MGC125789|MGC125791|MGC125792|MGC125793|PRO34150 |
| Gene Description | C-type lectin domain family 4, member C |
| Storage Conditions | Store at -80ºC for 12 Month.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | FMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SEC-HPLC and Tris-Bis PAGE |
| Storage Buffer | In 20 mM Tris, 300 mM NaCl, 200 mM L-Arginine PH (pH 8.5) |
| Gene ID | 170482 |
More info
Human CLEC4C (Q8WTT0-1, 46 a.a. - 213 a.a.) partial recombinant protein with His tag at N-terminus expressed in HEK293 cells.