View larger
Human CD34 (P28906, 1 a.a. - 385 a.a.) full recombinant protein expressed in <i>Escherichia coli</i>.
AB-P9693
New product
CD34 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | CD34 |
| Gene Alias | - |
| Gene Description | CD34 molecule |
| Storage Conditions | Store at -20ºC to -80ºC for 12 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISS |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 7.5 (10 mM L-glutathione (reduced)) |
| Gene ID | 947 |
More info
Human CD34 (P28906, 1 a.a. - 385 a.a.) full recombinant protein expressed in Escherichia coli.