View larger
Human CD247 (P20963, 52 a.a. - 164 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli
AB-P9673
New product
CD247 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | CD247 |
| Gene Alias | CD3-ZETA|CD3H|CD3Q|CD3Z|T3Z|TCRZ |
| Gene Description | CD247 molecule |
| Storage Conditions | Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.15 M NaCl and 10% glycerol) |
| Gene ID | 919 |
More info
Human CD247 (P20963, 52 a.a. - 164 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.