View larger
Human CD8B (P10966, 22 a.a. - 170 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
AB-P9652
New product
CD8B (Human) Recombinant Protein
Não há pontos de recompensa para este produto.
Data sheet
| Size | 20 ug |
| Gene Name | CD8B |
| Gene Alias | CD8B1|LYT3|Leu2|Ly3|MGC119115 |
| Gene Description | CD8b molecule |
| Storage Conditions | Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol) |
| Gene ID | 926 |
More info
Human CD8B (P10966, 22 a.a. - 170 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.