View larger
Human CDKN3 (Q16667, 1 a.a. - 212 a.a.) full recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</i>
AB-P9613
New product
CDKN3 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CDKN3 |
| Gene Alias | CDI1|CIP2|FLJ25787|KAP|KAP1|MGC70625 |
| Gene Description | cyclin-dependent kinase inhibitor 3 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.1 M NaCl and 40% glycerol) |
| Gene ID | 1033 |
More info
Human CDKN3 (Q16667, 1 a.a. - 212 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.