AB-P9576
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Size | 2 x 10 ug |
Gene Name | Cxcl12 |
Gene Alias | AI174028|PBSF|PBSF/SDF-1|SDF-1|Scyb12|Sdf1|Sdf1a|Sdf1b|TLSF|TLSF-a|TLSF-b|TPAR1 |
Gene Description | chemokine (C-X-C motif) ligand 12 |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Immunogen Prot. Seq | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM |
Form | Lyophilized |
Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Storage Buffer | Lyophilized from sterile distilled Water is 0.5 mg/mL |
Gene ID | 20315 |