View larger
Bovine PF4 (P02777, 1 a.a. - 88 a.a.) full recombinant protein expressed in <i>Escherichia coli</i>.
AB-P9562
New product
PF4 (Bovine) Recombinant Protein
Ao comprar este produto pode ganhar até 8 pontos de fidelização. Seu carrinho totalizará 8 pontos de fidelização que podem ser convertidos num vale de desconto de 32.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | PF4 |
| Gene Alias | - |
| Gene Description | platelet factor 4 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ESSFPATFVPLPADSEGGEDEDLQCVCLKTTSGINPRHISSLEVIGAGTHCPSPQLLATKKTGRKICLDQQRPLYKKILKKLLDGDES |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 507790 |
More info
Bovine PF4 (P02777, 1 a.a. - 88 a.a.) full recombinant protein expressed in Escherichia coli.