View larger
Human CCL13 (Q99616, 24 a.a. - 98 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli<
AB-P9520
New product
CCL13 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | CCL13 |
| Gene Alias | CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1 |
| Gene Description | chemokine (C-C motif) ligand 13 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (1 mM DTT, 0.1 M NaCl and 10% glycerol) |
| Gene ID | 6357 |
More info
Human CCL13 (Q99616, 24 a.a. - 98 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.