View larger
Human CXCL17 (Q6UXB2, 22 a.a. - 119 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P9432
New product
CXCL17 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | CXCL17 |
| Gene Alias | DMC|Dcip1|MGC138300|UNQ473|VCC-1|VCC1 |
| Gene Description | chemokine (C-X-C motif) ligand 17 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 284340 |
More info
Human CXCL17 (Q6UXB2, 22 a.a. - 119 a.a.) partial recombinant protein expressed in Escherichia coli.