View larger
Human CXCL14 (O95715, 35 a.a. - 111 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia col
AB-P9419
New product
CXCL14 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | CXCL14 |
| Gene Alias | BMAC|BRAK|KS1|Kec|MGC10687|MIP-2g|NJAC|SCYB14|bolekine |
| Gene Description | chemokine (C-X-C motif) ligand 14 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MKHHHHHHASSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 9547 |
More info
Human CXCL14 (O95715, 35 a.a. - 111 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.