View larger
Mouse Cd200r1 partial recombinant proteind with hIgG-His tag in C-terminus expressed in Insect Cells.
AB-P9350
New product
Cd200r1 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | Cd200r1 |
| Gene Alias | CD200R|Mox2r|OX2R |
| Gene Description | CD200 receptor 1 |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | ADPTDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 57781 |
More info
Mouse Cd200r1 partial recombinant proteind with hIgG-His tag in C-terminus expressed in Insect Cells.