View larger
Rat Vegfa recombinant protein in?<i>Saccharomyces cerevisiae</i>.
AB-P9319
New product
Vegfa (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 12 pontos de fidelização. Seu carrinho totalizará 12 pontos de fidelização que podem ser convertidos num vale de desconto de 48.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | Vegfa |
| Gene Alias | VEGF164|Vegf |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 83785 |
More info
Rat Vegfa recombinant protein in?Saccharomyces cerevisiae.